PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P07410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bHLH
Protein Properties Length: 93aa    MW: 10472.8 Da    PI: 9.3975
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P07410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH25.72.1e-0821601554
                           HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                    HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                           +iN+  ++L+ +lP+a   +s ++s a +L+++++YI+sL
  GSMUA_Achr2P07410_001 21 QINDLVSKLQAVLPEARIRRSDRVSAAKVLQETCNYIRSL 60
                           8**************8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.829660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.2E-102081IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.4E-82079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.1E-52160IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRPRSWQ SSSASRITDE QINDLVSKLQ AVLPEARIRR SDRVSAAKVL QETCNYIRSL  60
HREVDDLSER LSELLASTES SSAQAAIIRS LLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389574.12e-58PREDICTED: transcription factor ILI6-like
SwissprotB8APB57e-39ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR27e-39ILI6_ORYSJ; Transcription factor ILI6
TrEMBLM0S5Y22e-58M0S5Y2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P07410_0015e-58(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-23bHLH family protein